Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Calcitonin related polypeptide beta

Gene Aliases

Beta-CGRP; beta-type CGRP; CALC2; calcitonin 2; calcitonin gene-related peptide 2; calcitonin gene-related peptide II; CGRP2; CGRP-II.

Gene ID

797

Accession Number

NP_000719

Reactivity

Homo sapiens|Human

Target

CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.

Type

Protein

Source

E.coli

Sequence

MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CALCB

Protein Name

Calcitonin gene-related peptide 2

Gene Name URL

CALCB

Nucleotide Accession Number

NM_000728

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Death Receptor 6 Recombinant Protein
91-950 0.05 mg

Death Receptor 6 Recombinant Protein

Sign In for Pricing
View Details
Magic™ Membrane Protein Human OR4A5 (Olfactory receptor family 4 subfamily A member 5) Expressed in vitro E.coli expression system, Full Length
MPX3187K Each

Magic™ Membrane Protein Human OR4A5 (Olfactory receptor family 4 subfamily A member 5) Expressed in vitro E.coli expression system, Full Length

Sign In for Pricing
View Details
DAPI (hydrochloride)
C3362-5 5 mg

DAPI (hydrochloride)

Sign In for Pricing
View Details
IL34 siRNA (Human)
MBS8239554-01 15 nmol

IL34 siRNA (Human)

Sign In for Pricing
View Details
IL34 siRNA (Human)
MBS8239554-02 30 nmol

IL34 siRNA (Human)

Sign In for Pricing
View Details
IL34 siRNA (Human)
MBS8239554-03 5x 30 nmol

IL34 siRNA (Human)

Sign In for Pricing
View Details