Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BOLL Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Boule homolog, RNA binding protein

Gene Aliases

Bol, boule-like; BOULE; boule-like RNA binding protein; protein boule-like.

Gene ID

66037

Accession Number

NP_001271287

Reactivity

Homo sapiens|Human

Target

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity) .

Type

Protein

Source

E.coli

Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BOLL

Protein Name

Protein boule-like

Gene Name URL

BOLL

Nucleotide Accession Number

NM_001284358

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERF Human Pre-designed siRNA Set A
HY-RS04488 1 Set

ERF Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
CD137 (TNFRSF9) (NM_001561) Human Recombinant Protein
PH32843M2 20 µg

CD137 (TNFRSF9) (NM_001561) Human Recombinant Protein

Sign In for Pricing
View Details
HBXIP (LAMTOR5, Ragulator Complex Protein LAMTOR5, Hepatitis B Virus X-interacting Protein, HBV X-interacting Protein, HBX-interacting Protein, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5, XIP) (FITC)
127739-FITC 100 µL

HBXIP (LAMTOR5, Ragulator Complex Protein LAMTOR5, Hepatitis B Virus X-interacting Protein, HBV X-interacting Protein, HBX-interacting Protein, Late Endosomal/Lysosomal Adaptor and MAPK and MTOR Activator 5, XIP) (FITC)

Sign In for Pricing
View Details
YM 2447690
167089 10 mg

YM 2447690

Sign In for Pricing
View Details
hnRNP A2B1 (HNRNPA2B1) (NM_031243) Human Tagged Lenti ORF Clone
RC224241L2 10 µg

hnRNP A2B1 (HNRNPA2B1) (NM_031243) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PCDHGA9 Human siRNA Oligo Duplex (Locus ID 56107)
SR311080 1 Kit

PCDHGA9 Human siRNA Oligo Duplex (Locus ID 56107)

Sign In for Pricing
View Details