What is the catalog number for GHRL Recombinant Protein (Human)?

The catalog number for GHRL Recombinant Protein (Human) is OPCA04782-20UG.

What sizes are available for GHRL Recombinant Protein (Human)?

GHRL Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is GHRL Recombinant Protein (Human) in stock?

GHRL Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

GHRL Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ghrelin and obestatin prepropeptide

Gene Aliases

Appetite-regulating hormone; ghrelin, growth hormone secretagogue receptor ligand; ghrelin/obestatin preprohormone; ghrelin/obestatin prepropeptide; Growth hormone secretagogue; growth hormone-releasing peptide; In2c-preproghrelin; motilin-related peptide; MTLRP; prepro-appetite regulatory hormone; preproghrelin; Protein M46.

Gene ID

51738

Accession Number

NP_001128413

Reactivity

Homo sapiens|Human

Target

Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR) . Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation.

Type

Protein

Source

E.coli

Sequence

MPSPGTVCSLLLLGMLWLDLAMAGSSFLSPEHQRVQQRKESKKPPAKLQPRALAGWLRPEDGGQAEGAEDEMEVRFNAPFDVGIKLSGVQYQQHSQALGKFLQDILWEEAKEAPADK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.