Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEBPG Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

CCAAT enhancer binding protein gamma

Gene Aliases

C/EBP gamma; CCAAT/enhancer binding protein (C/EBP), gamma; CCAAT/enhancer-binding protein gamma; GPE1BP; IG/EBP-1.

Gene ID

1054

Accession Number

NP_001239225

Reactivity

Homo sapiens|Human

Target

Transcription factor that binds to the promoter and the enhancer regions of target genes. Binds to the enhancer element PRE-I (positive regulatory element-I) of the IL-4 gene (PubMed:7665092) . Binds to the promoter and the enhancer of the immunoglobulin heavy chain. Binds to GPE1, a cis-acting element in the G-CSF gene promoter.

Type

Protein

Source

E.coli

Sequence

MSKISQQNSTPGVNGISVIHTQAHASGLQQVPQLVPAGPGGGGKAVAPSKQSKKSSPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKELSVLKDLFLEHAHNLADNVQSISTENTTADGDNAGQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CEBPG

Protein Name

CCAAT/enhancer-binding protein gamma

Gene Name URL

CEBPG

Nucleotide Accession Number

NM_001252296

More Discoveries

Explore Other Products

Browse additional items from our catalog

(5-Methyl-2-pyridinyl) phenylmethanone
OR1081965 1 Each

(5-Methyl-2-pyridinyl) phenylmethanone

Sign In for Pricing
View Details
Lentiviral human RYR3 shRNA (UAS) - Lentiviral human RYR3 shRNA (UAS, iRFP) plasmid
GTR15307483 1 Vial

Lentiviral human RYR3 shRNA (UAS) - Lentiviral human RYR3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Succinate dehydrogenase-IN-6
HY-172363 1 Each

Succinate dehydrogenase-IN-6

Sign In for Pricing
View Details
SUOX Peptide - middle region
orb1999966 100 µg

SUOX Peptide - middle region

Sign In for Pricing
View Details
Paox (NM_153783) Mouse Recombinant Protein
TP508103 20 µg

Paox (NM_153783) Mouse Recombinant Protein

Sign In for Pricing
View Details
Mag Beads Polymer COOH (300 nm)
orb2300324-01 5 mL

Mag Beads Polymer COOH (300 nm)

Sign In for Pricing
View Details