Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUOX Peptide - middle region

SUOX Peptide - middle region

Product Specifications

UniProt

P51687

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SUOX Rabbit Polyclonal Antibody (orb589946) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000447.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RHVKWLGRVSVQPEESYSHWQRRDYKGFSPSVDWETVDFDSAPSIQELPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human parainfluenza 1 virus Phosphoprotein (P/C), partial
MBS1238812 Inquire

Recombinant Human parainfluenza 1 virus Phosphoprotein (P/C), partial

Sign In for Pricing
View Details
CLEC7A Protein Vector (Human) (pPB-N-His)
PV009762 500 ng

CLEC7A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Myl10 Mouse siRNA Oligo Duplex (Locus ID 59310)
SR405187 1 Kit

Myl10 Mouse siRNA Oligo Duplex (Locus ID 59310)

Sign In for Pricing
View Details
Chicken Phosphorylated Tau (PT) ELISA Kit
MBS9366668 Inquire

Chicken Phosphorylated Tau (PT) ELISA Kit

Sign In for Pricing
View Details
ERP44 sgRNA CRISPR Lentivector set (Human)
K0694201 3x 1.0 µg

ERP44 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Anti-NCAPD2 Rabbit mAb
CMA4463-01 30 µL

Recombinant Anti-NCAPD2 Rabbit mAb

Sign In for Pricing
View Details