Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLFA Recombinant Protein (Staphylococcus aureus)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Fibrinogen receptor A; Fibrinogen-binding protein A.

Accession Number

WP_001056223

Reactivity

Staphylococcus aureus

Target

Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps (By similarity) .

Type

Protein

Source

Yeast

Sequence

GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CLFA

Protein Name

Clumping factor A

Gene Name URL

CLFA

Nucleotide Accession Number

NC_002951

More Discoveries

Explore Other Products

Browse additional items from our catalog

SensiStain™ Anti-TSH Antibody
HY500055 0.1 mL

SensiStain™ Anti-TSH Antibody

Sign In for Pricing
View Details
CHCHD6 Peptide - N-terminal region
orb2011244 100 µg

CHCHD6 Peptide - N-terminal region

Sign In for Pricing
View Details
Rat Monoclonal Autoimmune Regulator/AIRE Antibody (609930) [mFluor Violet 450 SE]
FAB6184MFV450 0.1 mL

Rat Monoclonal Autoimmune Regulator/AIRE Antibody (609930) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Mouse UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (OGT) ELISA Kit
YP-W27791-01 48 Tests

Mouse UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (OGT) ELISA Kit

Sign In for Pricing
View Details
Mouse UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (OGT) ELISA Kit
YP-W27791-02 96 Tests

Mouse UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit (OGT) ELISA Kit

Sign In for Pricing
View Details
CNIH2 Antibody; FITC conjugated
MBS7001221-01 0.05 mg

CNIH2 Antibody; FITC conjugated

Sign In for Pricing
View Details