Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHCHD6 Peptide - N-terminal region

CHCHD6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC13016, CHCM1, PPP1R23

UniProt

Q9BRQ6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHCHD6 Rabbit Polyclonal Antibody (orb584676) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115719

Preservative

Lyophilized powder

AA Sequence

LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S35E2, NT (SLC35E2B, KIAA0447, Solute carrier family 35 member E2B) (Biotin)
MBS6344746-01 0.2 mL

S35E2, NT (SLC35E2B, KIAA0447, Solute carrier family 35 member E2B) (Biotin)

Sign In for Pricing
View Details
S35E2, NT (SLC35E2B, KIAA0447, Solute carrier family 35 member E2B) (Biotin)
MBS6344746-02 5x 0.2 mL

S35E2, NT (SLC35E2B, KIAA0447, Solute carrier family 35 member E2B) (Biotin)

Sign In for Pricing
View Details
Anti-GNRHR Antibody Picoband® HRP Conjugated
A01442-2-HRP 100 µg/Vial

Anti-GNRHR Antibody Picoband® HRP Conjugated

Sign In for Pricing
View Details
CD38 (NM_001775) Human Tagged Lenti ORF Clone
RC203179L3 10 µg

CD38 (NM_001775) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
N-Myc Rabbit Monoclonal Antibody
E56G4114 100 µL

N-Myc Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Antibacterial agent 46
MBS5799443 Inquire

Antibacterial agent 46

Sign In for Pricing
View Details