Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCPT4 Recombinant Protein (Mouse)

Product Specifications

CAS Number

9000-83-3

Gene Name

Mast cell protease 4

Gene Aliases

Mast cell protease 4; Mcp; Mcp-; Mcp4; Mcp-4; MMCP-; MMCP-4; MMCP-4A; MMCP-4B; MSMCP; myo; myonase; serosal mast cell protease.

Gene ID

17227

Accession Number

NP_034909

Reactivity

Mouse|Mus musculus

Target

Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.

Type

Protein

Source

Yeast

Sequence

IIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVMTAAHCSGREITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPGKMCRAAGWGRTGVTEPTSDTLREVKLRIMDKEACKNYWHYDYNLQVCVGSPRKKRSAYKGDSGGPLLCAGVAHGIVSYGRGDAKPPAVFTRISSYVPWINRVIKGE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

27.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Mcpt4

Protein Name

Mast cell protease 4

Gene Name URL

Mcpt4

Nucleotide Accession Number

NM_010779

More Discoveries

Explore Other Products

Browse additional items from our catalog

ONECUT3 Rabbit Polyclonal Antibody
orb575121 100 µL

ONECUT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MYH1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-42269R-BF350 100 µL

MYH1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
(6-chloro-2-fluoro-3-methylphenyl) triethylsilane
PC1021006-01 250 mg

(6-chloro-2-fluoro-3-methylphenyl) triethylsilane

Sign In for Pricing
View Details
(6-chloro-2-fluoro-3-methylphenyl) triethylsilane
PC1021006-02 500 mg

(6-chloro-2-fluoro-3-methylphenyl) triethylsilane

Sign In for Pricing
View Details
(6-chloro-2-fluoro-3-methylphenyl) triethylsilane
PC1021006-03 1 g

(6-chloro-2-fluoro-3-methylphenyl) triethylsilane

Sign In for Pricing
View Details
(S, R, S) -AHPC-PEG4-N3
HY-103601-01 25 mg

(S, R, S) -AHPC-PEG4-N3

Sign In for Pricing
View Details