Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Conglutin-7 Recombinant Protein (Peanut)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

2S protein 1; Seed storage protein SSP1; Seed storage protein SSP2.

Reactivity

Arachis hypogaea|Peanut

Target

Weak inhibitor of trypsin.

Type

Protein

Source

E.coli

Sequence

RQQWELQGDRRCQSQLERANLRPCEQHLMQKIQRDEDSYGRDPYSPSQDPYSPSQDPDRRDPYSPSPYDRRGAGSSQHQERCCNELNEFENNQRCMCEALQQIMENQSDRLQGRQQEQQFKRELRNLPQQCGLRAPQRCDLEVESGGRDRY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

22 kda

Protein Length

Recombinant

Protein Name

Conglutin-7

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AQP1 Protein Lysate (Human) with C-Ha Tag
12214031 100 µg

AQP1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide Receptor, Recombinant, Human, aa22-138, His-Tag, Myc-Tag
584636-01 20 µg

Gastric Inhibitory Polypeptide Receptor, Recombinant, Human, aa22-138, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Gastric Inhibitory Polypeptide Receptor, Recombinant, Human, aa22-138, His-Tag, Myc-Tag
584636-02 100 µg

Gastric Inhibitory Polypeptide Receptor, Recombinant, Human, aa22-138, His-Tag, Myc-Tag

Sign In for Pricing
View Details
B4GALT1 Rabbit Polyclonal Antibody
orb589047 100 µL

B4GALT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human HB-EGF MAb (Clone 880217R)
MAB2592-SP 25 µg

Human HB-EGF MAb (Clone 880217R)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Energy-coupling factor transporter transmembrane protein EcfT (ecfT)
orb2911298-01 20 µg

Recombinant Bacillus subtilis Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Sign In for Pricing
View Details