Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

This Recombinant Bacillus subtilis Energy-coupling factor transporter transmembrane protein EcfT (ecfT) spans the amino acid sequence from region 1-265.

Product Specifications

Product Name Alternative

Energy-coupling factor transporter transmembrane protein EcfT, ECF transporter T component EcfT

UniProt

P70972

Expression Region

1-265

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDSMIIGKYVPGTSLVHRLDPRTKLITIFLFVCIVFLANNVQTYALLGLFTIGVVSLTR VPFSFLMKGLKPIIWIVLFTFLLHILMTHEGPIIFQIGFFKVYEGGLVQGIFISLRFVYL ILITTLLTLTTTPIEITDGMEQLLNPLKKLKLPVHELALMMSISLRFIPTLMEETDKIMK AQMARGVDFTSGPVKERVKAIVPLLVPLFVSAFKRAEELAVAMEARGYQGGEGRTKYRKL VWTGKDTSVIVSLIVLAALLFFLRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C6orf89 siRNA (Human)
CRJ6521-01 15 nmol

C6orf89 siRNA (Human)

Sign In for Pricing
View Details
C6orf89 siRNA (Human)
CRJ6521-02 30 nmol

C6orf89 siRNA (Human)

Sign In for Pricing
View Details
ACTG1 Antibody
CSB-PA001222GA01HU 100 µL

ACTG1 Antibody

Sign In for Pricing
View Details
Wnt4, CT (Protein Wnt-4, UNQ426/PRO864) (MaxLight 550) discontinued
W3021-01A-ML550 100 µL

Wnt4, CT (Protein Wnt-4, UNQ426/PRO864) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-ATRIP Antibody Picoband® (Dylight488 Conjugate)
A03862-2-Dylight488 100 µg

Anti-ATRIP Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
RYK Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-62264R-BF488-01 20 µL

RYK Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details