Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hmgb1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

High mobility group box 1

Gene Aliases

Amphoterin; High mobility group protein 1; high mobility group protein B1; high-mobility group (nonhistone chromosomal) protein 1; HMG1; HMG-1; HMG3; SBP-1; Sulfoglucuronyl carbohydrate binding protein.

Gene ID

3146

Reactivity

Homo sapiens|Human

Target

Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V (D) J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury (PubMed:27362237) . Released to the extracellular environment can bind DNA, nucleosomes, IL-1 beta, CXCL12, AGER isoform 2/sRAGE, lipopolysaccharide (LPS) and lipoteichoic acid (LTA), and activates cells through engagement of multiple surface receptors. In the extracellular compartment fully reduced HMGB1 (released by necrosis) acts as a chemokine, disulfide HMGB1 (actively secreted) as a cytokine, and sulfonyl HMGB1 (released from apoptotic cells) promotes immunological tolerance (PubMed:23519706, PubMed:23446148, PubMed:23994764, PubMed:25048472) . Has proangiogdenic activity (By similarity) . May be involved in platelet activation (By similarity) . Binds to phosphatidylserine and phosphatidylethanolamide (By similarity) . Bound to RAGE mediates signaling for neuronal outgrowth (By similarity) . May play a role in accumulation of expanded polyglutamine (polyQ) proteins such as huntingtin (HTT) or TBP (PubMed:23303669, PubMed:25549101) .

Type

Protein

Source

Yeast

Sequence

GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HMGB1

Host or Source

Human

Protein Name

High mobility group protein B1

Gene Name URL

HMGB1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBA Rabbit pAb
APA4932-01 30 µL

GBA Rabbit pAb

Sign In for Pricing
View Details
GBA Rabbit pAb
APA4932-02 50 μL

GBA Rabbit pAb

Sign In for Pricing
View Details
GBA Rabbit pAb
APA4932-03 100 µL

GBA Rabbit pAb

Sign In for Pricing
View Details
INO80C Rabbit Polyclonal Antibody (Biotin)
orb2086183 100 µL

INO80C Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MAPK12 Antibody (C-term) [APR05919G]
APR05919G-01 50 µL

MAPK12 Antibody (C-term) [APR05919G]

Sign In for Pricing
View Details
MAPK12 Antibody (C-term) [APR05919G]
APR05919G-02 100 µL

MAPK12 Antibody (C-term) [APR05919G]

Sign In for Pricing
View Details