Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INO80C Rabbit Polyclonal Antibody (Biotin)

INO80C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

IES6, hIes6, C18orf37

UniProt

Q6PI98

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human INO80C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: LBI3D11]
AMM12481VCF 100 µg

CD10 (MME) Mouse Monoclonal Antibody [Clone ID: LBI3D11]

Sign In for Pricing
View Details
Ppp1r7 siRNA Oligos set (Rat)
37461176 3x 5 nmol

Ppp1r7 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1) (AP)
MBS6133488-01 0.1 mL

ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1) (AP)

Sign In for Pricing
View Details
ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1) (AP)
MBS6133488-02 5x 0.1 mL

ROBO1 (Roundabout Homolog 1, Deleted in U Twenty Twenty, H-Robo-1, DUTT1) (AP)

Sign In for Pricing
View Details
Stannin CRISPR/Cas9 KO Plasmid (m)
sc-423055 20 µg

Stannin CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
PPP2R2B, ID (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta) (MaxLight 490)
MBS6495516-01 0.1 mL

PPP2R2B, ID (Serine/Threonine-protein Phosphatase 2A 55kD Regulatory Subunit B beta Isoform, PP2A, Subunit B Isoform B55-beta, PP2A Subunit B Isoform PR55-beta, PP2A Subunit B Isoform R2-beta, PP2A Subunit B Isoform beta) (MaxLight 490)

Sign In for Pricing
View Details