Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bla g 4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen Bla g IV.

Reactivity

Blattella germanica

Target

Probable ligand-binding protein.

Type

Protein

Source

Yeast

Sequence

NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

21.8 kDa

Protein Length

Recombinant

Host or Source

Blattella germanica

Protein Name

Allergen Bla g 4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSH6 Antibody
orb2642520 100 µg

MSH6 Antibody

Sign In for Pricing
View Details
Human HSPA9/Mortalin/GRP75 Antibody
E55A12791 100 µg

Human HSPA9/Mortalin/GRP75 Antibody

Sign In for Pricing
View Details
Guinea Pig Olfactory receptor 2A5 (OR2A5) ELISA Kit
GTR10333632 96 Well

Guinea Pig Olfactory receptor 2A5 (OR2A5) ELISA Kit

Sign In for Pricing
View Details
Tmem86a Rabbit Polyclonal Antibody (Biotin)
orb2108173 100 µL

Tmem86a Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
LFA 3 Human
OM301529-01 20 µg

LFA 3 Human

Sign In for Pricing
View Details
LFA 3 Human
OM301529-02 100 µg

LFA 3 Human

Sign In for Pricing
View Details