Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem86a Rabbit Polyclonal Antibody (Biotin)

Tmem86a Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AI414959, AW742698, 1810054O13Rik

UniProt

Q9D8N3

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tmem86a

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MVSPVTVVKSEGPKLVPFFKATCVYFVLWLPSSSPSWVSALIKCLPIFCL

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_080712

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit
MBS2700740-01 24 Strip Well

Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit

Sign In for Pricing
View Details
Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit
MBS2700740-02 48 Well

Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit

Sign In for Pricing
View Details
Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit
MBS2700740-03 96 Well

Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit

Sign In for Pricing
View Details
Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit
MBS2700740-04 5x 96 Well

Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit

Sign In for Pricing
View Details
Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit
MBS2700740-05 10x 96 Well

Sheep Brain Derived Neurotrophic Factor (BDNF) ELISA Kit

Sign In for Pricing
View Details
Rat Ccdc62 Pre-designed siRNA Set B
SI202162B 1 Each

Rat Ccdc62 Pre-designed siRNA Set B

Sign In for Pricing
View Details