Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tnfsf11 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Tumor necrosis factor (ligand) superfamily, member 11

Gene Aliases

Ly10; Ly109l; O; OD; ODF; OPG ligand; OPGL; osteoclast differentiation factor; osteoprotegerin ligand; R; RANKL; receptor activator of NF-kappaB ligand; receptor activator of nuclear factor kappa-B ligand; TNF-related activation-induced cytokine; Tra; Trance; tumor necrosis factor ligand superfamily member 11; tumor necrosis factor-related activation-induced cytokine.

Gene ID

21943

Reactivity

Mouse|Mus musculus

Target

Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (By similarity) . Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts (PubMed:24039232) . During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation (PubMed:23395171, PubMed:26644563) .

Type

Protein

Source

E.coli

Sequence

YFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

Varies by lot. See vial for concentration.

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

43.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

Tnfsf11

Host or Source

Mouse

Protein Name

Tumor necrosis factor ligand superfamily member 11

Gene Name URL

Tnfsf11

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPNE6, NT (CPNE6, Copine-6, Copine VI, Neuronal-copine) (AP)
MBS6288351-01 0.2 mL

CPNE6, NT (CPNE6, Copine-6, Copine VI, Neuronal-copine) (AP)

Sign In for Pricing
View Details
CPNE6, NT (CPNE6, Copine-6, Copine VI, Neuronal-copine) (AP)
MBS6288351-02 5x 0.2 mL

CPNE6, NT (CPNE6, Copine-6, Copine VI, Neuronal-copine) (AP)

Sign In for Pricing
View Details
ARF3 Rabbit pAb (APR27957N)
APR27957N-01 50 µL

ARF3 Rabbit pAb (APR27957N)

Sign In for Pricing
View Details
ARF3 Rabbit pAb (APR27957N)
APR27957N-02 100 µL

ARF3 Rabbit pAb (APR27957N)

Sign In for Pricing
View Details
ARF3 Rabbit pAb (APR27957N)
APR27957N-03 200 µL

ARF3 Rabbit pAb (APR27957N)

Sign In for Pricing
View Details
Geranyl Phenyl Acetate for Synthesis
104335 500 g

Geranyl Phenyl Acetate for Synthesis

Sign In for Pricing
View Details