Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNASE1L3 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

Deoxyribonuclease 1 like 3

Gene Aliases

Deoxyribonuclease gamma; deoxyribonuclease I-like 3; deoxyribonuclease I-like III; DHP2; DNAS1L3; DNase gamma; DNase I homolog protein 2; DNase I homolog protein DHP2; DNase I-like 3; Liver and spleen DNase; LSD; LS-DNase; SLEB16.

Gene ID

1776

Accession Number

NP_001243489.1

Reactivity

Homo sapiens|Human

Target

Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends (By similarity) . Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA (PubMed:9070308, PubMed:9714828, PubMed:14646506, PubMed:10807908, PubMed:27293190) . Acts in internucleosomal DNA fragmentation (INDF) during apoptosis and necrosis (PubMed:23229555, PubMed:24312463) . The role in apoptosis includes myogenic and neuronal differentiation, and BCR-mediated clonal deletion of self-reactive B cells (By similarity) . Is active on chromatin in apoptotic cell-derived membrane-coated microparticles and thus suppresses anti-DNA autoimmunity (PubMed:27293190) . Together with DNASE1, plays a key role in degrading neutrophil extracellular traps (NETs) (By similarity) . NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation (By similarity) . Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation (By similarity) .

Type

Protein

Source

E.coli

Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Purification

Affinity purified using AC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

60.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DNASE1L3

Protein Name

Deoxyribonuclease gamma

Gene Name URL

DNASE1L3

Nucleotide Accession Number

NM_001256560.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 8 shRNA (m) Lentiviral Particles
sc-62666-V 200 µL

Calpain 8 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Candida glabrata Heat shock protein SSB (SSB1), partial
MBS1298897 Inquire

Recombinant Candida glabrata Heat shock protein SSB (SSB1), partial

Sign In for Pricing
View Details
C14orf180 Rabbit Polyclonal Antibody (FITC)
orb2119047 100 µL

C14orf180 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MUNC-18a Peptide
DF7336-BP 1 mg

MUNC-18a Peptide

Sign In for Pricing
View Details
PRPF19 (Pre-mRNA-Processing Factor 19, PSO4, SNEV, PRP19, UBOX4, hPSO4, NMP200) (MaxLight 490)
MBS6433333-01 0.1 mL

PRPF19 (Pre-mRNA-Processing Factor 19, PSO4, SNEV, PRP19, UBOX4, hPSO4, NMP200) (MaxLight 490)

Sign In for Pricing
View Details
PRPF19 (Pre-mRNA-Processing Factor 19, PSO4, SNEV, PRP19, UBOX4, hPSO4, NMP200) (MaxLight 490)
MBS6433333-02 5x 0.1 mL

PRPF19 (Pre-mRNA-Processing Factor 19, PSO4, SNEV, PRP19, UBOX4, hPSO4, NMP200) (MaxLight 490)

Sign In for Pricing
View Details