Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PNTx4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Insecticidal neurotoxin Tx4 (6-1) .

Reactivity

Phoneutria nigriventer

Target

This neurotoxin binds at site 3 of insect voltage-activated sodium channels (Nav) and prolongs evoked axonal action potentials by a slowing down of sodium current inactivation (PubMed:12770132) . The toxin also inhibits glutamate uptake from rat brain synaptosomes (PubMed:14757211) . It reversibly inhibits the N-methyl-D-aspartate (NMDA) -subtype of ionotropic glutamate receptor (GRIN) (By similarity) . In addition, the toxin shows antinociceptive effect in all rat pain models tested (inflammatory, neuropathic and nociceptive) (PubMed:27077886) . The antinociceptive effect is partially blocked when selective antagonists of both mu- and delta-opioid receptors are administered, revealing that the antinociceptive effect of the toxin involves both opiod and cannabinoid endogenous systems (PubMed:27077886) . In vivo, it is highly toxic to house fly (Musca domestica), toxic to cockroach, but has no effect when intracerebroventricularly injected into mice (PubMed:7778132, PubMed:12770132) .

Type

Protein

Source

Yeast

Sequence

CGDINAACKEDCDCCGYTTACDCYWSKSCKCREAAIVIYTAPKKKLTC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

7.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PNTX4

Host or Source

Phoneutria nigriventer

Protein Name

Delta-ctenitoxin-Pn1a

Gene Name URL

PNTX4

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Piroheptine (hydrochloride)
HY-116550 1 Each

Piroheptine (hydrochloride)

Sign In for Pricing
View Details
RYBP Protein Vector (Human) (pPB-N-His)
PV036630 500 ng

RYBP Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human BRI3BP sgRNA gene knockout kit - Lentiviral human BRI3BP sgRNA gene knockout kit (100)
GTR15358993 1 Vial

Lentiviral human BRI3BP sgRNA gene knockout kit - Lentiviral human BRI3BP sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
DUX4L8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV723457 1.0 µg DNA

DUX4L8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Hsa-miR-1306-3p inhibitor
HY-RI00237-01 5 nmol

Hsa-miR-1306-3p inhibitor

Sign In for Pricing
View Details
Hsa-miR-1306-3p inhibitor
HY-RI00237-02 20 nmol

Hsa-miR-1306-3p inhibitor

Sign In for Pricing
View Details