What is the catalog number for Nqo1 Recombinant Protein?

The catalog number for Nqo1 Recombinant Protein is OPCA03267-100UG.

What sizes are available for Nqo1 Recombinant Protein?

Nqo1 Recombinant Protein is available in the following size(s): 100 µg.

Is Nqo1 Recombinant Protein in stock?

Nqo1 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Nqo1 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

NAD (P) H dehydrogenase, quinone 1

Gene Aliases

AV001255; azoreductase; Di; Dia4; diaphorase 4 (NADH/NADPH) ; Dtd; DT-diaphorase; menadione reductase; NAD (P) H dehydrogenase (quinone) ; NAD (P) H dehydrogenase [quinone] 1; NAD (P) H menadione oxidoreductase 1, dioxin inducible; NAD (P) H:quinone oxidoreductase 1; NM; Nmo1; Nmo-1; Nmor1; NQ; Ox; Ox-; Ox1; Ox-1; phylloquinone reductase; QR; Qr1; quinone reductase 1.

Gene ID

18104

Accession Number

NP_032732.3

Reactivity

Mouse|Mus musculus

Target

The enzyme apparently serves as a quinone reductase in connection with conjugation reactions of hydroquinons involved in detoxification pathways as well as in biosynthetic processes such as the vitamin K-dependent gamma-carboxylation of glutamate residues in prothrombin synthesis.

Type

Protein

Source

Yeast

Sequence

AARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMKKEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.