Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Klebsiella pneumoniae OmpK36 (OmpK36)

Recombinant Klebsiella pneumoniae OmpK36 (OmpK36) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Klebsiella pneumoniae. Target Name: OmpK36 (OmpK36) . Accession Number: D6QLY3; OmpK36. Expression Region: 22-372aa. Tag Info: N-terminal 6xHis-tagged. Theoretical MW: 42.8kda. Target Synonyms: Outer membrane protein C; Phosphoporin PhoE; Porin OmpK36 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Klebsiella pneumoniae OmpK36 (OmpK36) is a purified Recombinant Protein.

Accession Number

D6QLY3; OmpK36

Expression Region

22-372aa

Host

E. coli

Target

OmpK36 (OmpK36)

Conjugation

Unconjugated

Tag

N-Terminal 6xHis-Tagged

Field of Research

Others

Endotoxin

Not Tested

Purity

>85% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

42.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Outer membrane protein C; Phosphoporin PhoE; Porin OmpK36

Species

Klebsiella pneumoniae

Protein Name

Recombinant Protein

AA Sequence

AEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGTSPTNNGRGALKQNGDGFGTSLTYDIYDGISAGFAYSHSKRNGDQNRLDKGRGDNAETYTGGLKYDANNIYLATQYTQTYNATRFSGNGESDSISGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDIEGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDENDFTRRAGISTDDVVALGLVYQF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal NSP 5 alpha 3 alpha Antibody
NB100-518 0.1 mL

Rabbit Polyclonal NSP 5 alpha 3 alpha Antibody

Sign In for Pricing
View Details
UNC5CL Adenovirus (Rat)
49184056 1.0 mL

UNC5CL Adenovirus (Rat)

Sign In for Pricing
View Details
Casp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7092107 1.0 µg DNA

Casp2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
STIP1 siRNA (Rat)
CRR3527-01 15 nmol

STIP1 siRNA (Rat)

Sign In for Pricing
View Details
STIP1 siRNA (Rat)
CRR3527-02 30 nmol

STIP1 siRNA (Rat)

Sign In for Pricing
View Details
Recombinant Halobacterium salinarum Tryptophan synthase alpha chain (trpA)
MBS1063840-01 0.02 mg (E-Coli)

Recombinant Halobacterium salinarum Tryptophan synthase alpha chain (trpA)

Sign In for Pricing
View Details