Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Levanase Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

2,6-beta-D-fructan fructanohydrolase; Endo-levanase.

Reactivity

Bacillus

Target

Catalyzes the hydrolysis of levan with endo-type specificity. The products of levan hydrolysis are a mixture of fructose and a series of fructooligosaccharides up to 12-mer, with levantriose being the major oligosaccharide obtained. Is not active towards sucrose.

Type

Protein

Source

Yeast

Sequence

LPWNDLGHVWSGSAVADTTNASGLFGSSGGKGLIAYYTSYNPDRHNGNQKIGLAYSTDRGRTWKYSEEHPVVIENPGKTGEDPGGWDFRDPKVVRDEANNRWVMVVSGGDHIRLFTSTNLLNWTLTDQF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

16.3 kDa

Protein Length

Recombinant

Host or Source

Bacillus sp.

Protein Name

Levanase

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF3 (N-term) Rabbit pAb
E2614615 100 µL

GDF3 (N-term) Rabbit pAb

Sign In for Pricing
View Details
Recombinant Brucella Ovis xylA Protein (aa 1-435)
VAng-Lsx5539-500gEcoli 500 µg (E. coli)

Recombinant Brucella Ovis xylA Protein (aa 1-435)

Sign In for Pricing
View Details
Human SOD2 Ready-To-Use IHC Kit
orb2984675 50 Tests

Human SOD2 Ready-To-Use IHC Kit

Sign In for Pricing
View Details
IκB-α (phospho Tyr42) Polyclonal Antibody
E20-60152 100 µg

IκB-α (phospho Tyr42) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Leukocyte surface antigen CD53 (CD53)
orb2917905-01 20 µg

Recombinant Human Leukocyte surface antigen CD53 (CD53)

Sign In for Pricing
View Details
Recombinant Human Leukocyte surface antigen CD53 (CD53)
orb2917905-02 100 µg

Recombinant Human Leukocyte surface antigen CD53 (CD53)

Sign In for Pricing
View Details