Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Leukocyte surface antigen CD53 (CD53)

This Recombinant Human Leukocyte surface antigen CD53 (CD53) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Leukocyte surface antigen CD53, Cell surface glycoprotein CD53, Tetraspanin-25, Tspan-25, CD_antigen= CD53

UniProt

P19397

Expression Region

1-219

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVG SIIMVVAFLGCMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTD SIHRYHSDNSTKAAWDSIQSFLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHS NFLYIGIITICVCVIEVLGMSFALTLNCQIDKTSQTIGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MCM2 Rabbit mAb
C05278-20ul 20 µL

MCM2 Rabbit mAb

Sign In for Pricing
View Details
Human Protein hairless (HR) ELISA Kit
MBS287061-01 48 Tests

Human Protein hairless (HR) ELISA Kit

Sign In for Pricing
View Details
Human Protein hairless (HR) ELISA Kit
MBS287061-02 96 Tests

Human Protein hairless (HR) ELISA Kit

Sign In for Pricing
View Details
Human Protein hairless (HR) ELISA Kit
MBS287061-03 5x 96 Tests

Human Protein hairless (HR) ELISA Kit

Sign In for Pricing
View Details
Human Protein hairless (HR) ELISA Kit
MBS287061-04 10x 96 Tests

Human Protein hairless (HR) ELISA Kit

Sign In for Pricing
View Details
HE4 (WFDC2) Human shRNA Plasmid Kit (Locus ID 10406)
TR318721 1 Kit

HE4 (WFDC2) Human shRNA Plasmid Kit (Locus ID 10406)

Sign In for Pricing
View Details