Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Envelope glycoprotein L Recombinant Protein

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL .

Product Specifications

CAS Number

9000-83-3

Gene Name

Envelope glycoprotein L

Gene Aliases

Envelope glycoprotein L; HHV5wtgp101.

Gene ID

3077416

Accession Number

YP_081555.1

Reactivity

Human Betaherpesvirus 5|Human cytomegalovirus|Human Herpesvirus 5

Target

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Acts as a functional inhibitor of gH and maintains gH in an inhibited form. Upon binding to host integrins, gL dissociates from gH leading to activation of the viral fusion glycoproteins gB and gH.

Type

Protein

Source

Yeast

Sequence

AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR

Purification

Affinity purified using IMAC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

29.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UL115

Host or Source

Human cytomegalovirus

Protein Name

Envelope glycoprotein L

Gene Name URL

UL115

Nucleotide Accession Number

NC_006273.2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pannexin 1 Rabbit mAb
E2R389199 100 µL

Pannexin 1 Rabbit mAb

Sign In for Pricing
View Details
Anti-AIMP2/p38 Rabbit pAb
GB114722-100 100 μL

Anti-AIMP2/p38 Rabbit pAb

Sign In for Pricing
View Details
Horse Angiostatin ELISA Kit
MBS006467-01 48 Well

Horse Angiostatin ELISA Kit

Sign In for Pricing
View Details
Horse Angiostatin ELISA Kit
MBS006467-02 96 Well

Horse Angiostatin ELISA Kit

Sign In for Pricing
View Details
Horse Angiostatin ELISA Kit
MBS006467-03 5x 96 Well

Horse Angiostatin ELISA Kit

Sign In for Pricing
View Details
Horse Angiostatin ELISA Kit
MBS006467-04 10x 96 Well

Horse Angiostatin ELISA Kit

Sign In for Pricing
View Details