What is the catalog number for Dac g 4 Recombinant Protein?

The catalog number for Dac g 4 Recombinant Protein is OPCA02844-20UG.

What sizes are available for Dac g 4 Recombinant Protein?

Dac g 4 Recombinant Protein is available in the following size(s): 20 µg.

Is Dac g 4 Recombinant Protein in stock?

Dac g 4 Recombinant Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Dac g 4 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Aliases

Allergen: Dac g 4

Reactivity

Dactylis glomerata

Target

On the 2D-gel the determined pI of this protein is 10.4, its MW is 60 kDa

Type

Protein

Source

Yeast

Sequence

DIYNYMEPYVSKVDPTDYFGNEQARTAWVDSGAQLGELSYGVLFNIQYVNYWFAP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol