CD99L2 Peptide - middle region
CD99L2 Peptide - middle region
Product Specifications
Product Name Alternative
CD99B, DKFZp761H2024, MIC2L1
UniProt
Q8TCZ2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CD99L2 Rabbit Polyclonal Antibody (orb584741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001229543
Preservative
Lyophilized powder
AA Sequence
RDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR10423341 96 Well
Sheep Activin receptor type 1B (ACVR1B) ELISA kit
Sign In for Pricing
View Details 
GTR15306169 1 Vial
Lentiviral human ITGA2 shRNA (UAS) - Lentiviral human ITGA2 shRNA (UAS, GFP) plasmid
Sign In for Pricing
View Details 
abx542217 96 Tests
Mouse Ras Homolog Enriched In Brain (RHEB) ELISA Kit
Sign In for Pricing
View Details