Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BALF5 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

DNA polymerase catalytic subunit

Gene Aliases

DNA polymerase catalytic subunit; HHV4_BALF5.

Gene ID

3783681

Accession Number

YP_401712.1

Reactivity

Epstein-Barr virus|Epstein-Barr Virus|Human Gammaherpesvirus 4

Target

Replicates viral genomic DNA in the late phase of lytic infection, producing long concatemeric DNA. The replication complex is composed of six viral proteins: the DNA polymerase, processivity factor, primase, primase-associated factor, helicase, and ssDNA-binding protein.

Type

Protein

Source

E.coli

Sequence

MSGGLFYNPFLRPNKGLLKKPDKEYLRLIPKCFQTPGAAGVVDVRGPQPPLCFYQDSLTVVGGDEDGKGMWWRQRAQEGTARPEADTHGSPLDFHVYDILETVYTHEKCAVIPSDKQGYVVPCGIVIKLLGRRKADGASVCVNVFGQQAYFYASAPQGLDVEFAVLSALKASTFDRRTPCRVSVEKVTRRSIMGYGNHAGDYHKITLSHP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BALF5

Host or Source

Epstein-Barr virus

Protein Name

DNA polymerase catalytic subunit

Gene Name URL

BALF5

Nucleotide Accession Number

NC_007605.1

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine galanin (GAL) ELISA Kit
201-10-0414 96 Tests

Porcine galanin (GAL) ELISA Kit

Sign In for Pricing
View Details
AFX1 (A-7) X
sc-373877 X 200 µg - 0.1 mL

AFX1 (A-7) X

Sign In for Pricing
View Details
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590)
orb2934330-01 20 µg

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590)

Sign In for Pricing
View Details
Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590)
orb2934330-02 100 µg

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590)

Sign In for Pricing
View Details
Immortalized Human Osteoarthritis Synovial Fibroblasts - SV40+hTERT
T0993 1x106 cells / 1.0 mL

Immortalized Human Osteoarthritis Synovial Fibroblasts - SV40+hTERT

Sign In for Pricing
View Details
Human Tamm Horsfall Protein ELISA Kit
GTR10345079 96 Well

Human Tamm Horsfall Protein ELISA Kit

Sign In for Pricing
View Details