Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1590 (MJ1590) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1590

UniProt

Q58985

Expression Region

1-105

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRISPLIAGLIGGFTAAILQALFKVFPPPAYGICIACHTRDLVNWIINHLFGTTLGMALV SKAFPVLTVVGIFIGALITTFIYKETELKQTHSPVYWFHIRNFSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Troponin T Type 2, Cardiac (TNNT2) Monoclonal Antibody
CAU30804-01 100 µL

Troponin T Type 2, Cardiac (TNNT2) Monoclonal Antibody

Sign In for Pricing
View Details
Troponin T Type 2, Cardiac (TNNT2) Monoclonal Antibody
CAU30804-02 200 µL

Troponin T Type 2, Cardiac (TNNT2) Monoclonal Antibody

Sign In for Pricing
View Details
Troponin T Type 2, Cardiac (TNNT2) Monoclonal Antibody
CAU30804-03 1 mL

Troponin T Type 2, Cardiac (TNNT2) Monoclonal Antibody

Sign In for Pricing
View Details
GCH1 Knockout KYSE150 Polyclonal Cells
ARG12288 1 Million

GCH1 Knockout KYSE150 Polyclonal Cells

Sign In for Pricing
View Details
PPIAP19 Protein Vector (Human) (pPM-C-His)
PV112553 500 ng

PPIAP19 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal HO-1/HMOX1/HSP32 Antibody [Janelia Fluor 549]
NBP1-77460JF549 0.1 mL

Rabbit Polyclonal HO-1/HMOX1/HSP32 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details