Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Tissue factor pathway inhibitor

Product Specifications

CAS Number

9000-83-3

Gene Name

Tissue factor pathway inhibitor

Gene Aliases

EPI; extrinsic pathway inhibitor; LACI; lipoprotein-associated coagulation inhibitor; tissue factor pathway inhibitor; tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) .

Gene ID

100009401

Reactivity

Oryctolagus cuniculus|Rabbit

Target

Inhibits factor X (X (a) ) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.

Type

Protein

Source

E.coli

Sequence

AAEEDEEFTNITDIKPPLQKPTHSFCAMKVDDGPCRAYIKRFFFNILTHQCEEFIYGGCEGNENRFESLEECKEKCARDYPKMTTKLTFQKGKPDFCFLEEDPGICRGYITRYFYNNQSKQCERFKYGGCLGNLNNFESLEECKNTCENPTSDFQVDDHRTQLNTVNNTLINQPTKAPRRWAFHGPSWCLPPADRGLCQANEIRFFYNAIIGKCRPFKYSGCGGNENNFTSKKACITACKKGFIPKSIKGGLIKTKRKKKKQPVKITYVETFVKKT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

35.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TFPI

Protein Name

Tissue factor pathway inhibitor

Gene Name URL

TFPI

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGC Antibody
A31058-100UL 100 µL

PGC Antibody

Sign In for Pricing
View Details
5'-Dig-Oligo d (T) 14; 25 ug
26-4514-02 25 µg

5'-Dig-Oligo d (T) 14; 25 ug

Sign In for Pricing
View Details
Recombinant human RABL5/IFT22 protein
ATGP2109-020 20 µg

Recombinant human RABL5/IFT22 protein

Sign In for Pricing
View Details
Anti-Cytochrome P450 17A1/CYP17A1 Rabbit pAb
GB112095-50 50 μL

Anti-Cytochrome P450 17A1/CYP17A1 Rabbit pAb

Sign In for Pricing
View Details
PAX8 Recombinant Rabbit mAb,PBS Only (SDT-R027)
S0B2071P-01 1 mg

PAX8 Recombinant Rabbit mAb,PBS Only (SDT-R027)

Sign In for Pricing
View Details
PAX8 Recombinant Rabbit mAb,PBS Only (SDT-R027)
S0B2071P-02 25 µg

PAX8 Recombinant Rabbit mAb,PBS Only (SDT-R027)

Sign In for Pricing
View Details