What is the catalog number for Recombinant human Ropporin-1B?

The catalog number for Recombinant human Ropporin-1B is OPCA00206-100UG.

What sizes are available for Recombinant human Ropporin-1B?

Recombinant human Ropporin-1B is available in the following size(s): 100 µg.

Is Recombinant human Ropporin-1B in stock?

Recombinant human Ropporin-1B is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant human Ropporin-1B

Product Specifications

CAS Number

9000-83-3

Gene Name

Rhophilin associated tail protein 1B

Gene Aliases

AKAP-binding sperm protein ropporin; rhophilin-associated protein 1B; ropporin, rhophilin associated protein 1B; ropporin-1B; testis tissue sperm-binding protein Li 83P.

Gene ID

152015

Reactivity

Homo sapiens|Human

Target

Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.

Type

Protein

Source

E.coli

Sequence

MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.