Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement C5 (C5), partial

Product Specifications

Product Name Alternative

C3 and PZP-like alpha-2-macroglobulin domain-containing protein 4

Abbreviation

Recombinant Human C5 protein, partial

Gene Name

C5

UniProt

P01031

Expression Region

678-751aa

Organism

Homo sapiens (Human)

Target Sequence

TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR

Tag

N-terminal 6xHis-Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled. Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes (PubMed:8182049) . C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Activation of C5 by a C5 convertase initiates the spontaneous assembly of the late complement components, C5-C9, into the membrane attack complex. C5b has a transient binding site for C6. The C5b-C6 complex is the foundation upon which the lytic complex is assembled.; FUNCTION

Molecular Weight

12.3 kDa

References & Citations

"Complete cDNA sequence of human complement pro-C5. Evidence of truncated transcripts derived from a single copy gene."Haviland D.L., Haviland J.C., Fleischer D.T., Hunt A., Wetsel R.A.J. Immunol. 146:362-368 (1991)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

D830031N03Rik (NM_001167918) Mouse Tagged Lenti ORF Clone
MR220887L4 10 µg

D830031N03Rik (NM_001167918) Mouse Tagged Lenti ORF Clone

Ask
View Details
rno-miR-146a-3p miRNA Mimic
MBS8302976-01 5 nmol

rno-miR-146a-3p miRNA Mimic

Ask
View Details
rno-miR-146a-3p miRNA Mimic
MBS8302976-02 10 nmol

rno-miR-146a-3p miRNA Mimic

Ask
View Details
rno-miR-146a-3p miRNA Mimic
MBS8302976-03 5x 10 nmol

rno-miR-146a-3p miRNA Mimic

Ask
View Details
[Des-His1,Glu9]-Glucagon amide TFA
T36638-01 10mg

[Des-His1,Glu9]-Glucagon amide TFA

Ask
View Details
[Des-His1,Glu9]-Glucagon amide TFA
T36638-02 1g

[Des-His1,Glu9]-Glucagon amide TFA

Ask
View Details