Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Histone H2B type 1-M

Product Specifications

CAS Number

9000-83-3

Gene Name

H2B clustered histone 14

Gene Aliases

H2B 291B; H2b-291b; Hist1h2; Hist1h2bm; histone 1, H2bm; histone cluster 1, H2bm; histone H2B type 1-M.

Gene ID

319186

Reactivity

Mouse|Mus musculus

Target

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

Type

Protein

Source

E.coli

Sequence

PEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

17.8 kDa

Protein Length

Recombinant

NCBI Gene Symbol

H2bc14

Protein Name

Histone H2B type 1-M

Gene Name URL

H2bc14

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bitopertin (R enantiomer)
orb1710249-01 50 mg

Bitopertin (R enantiomer)

Sign In for Pricing
View Details
Bitopertin (R enantiomer)
orb1710249-02 100 mg

Bitopertin (R enantiomer)

Sign In for Pricing
View Details
Bitopertin (R enantiomer)
orb1710249-03 25 mg

Bitopertin (R enantiomer)

Sign In for Pricing
View Details
OLIG1 Rabbit pAb, BF700 conjugated
orb2880885 100 µL

OLIG1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
ALK Mouse Monoclonal Antibody [Clone ID: OTI5G1]
TA801744S 30 µL

ALK Mouse Monoclonal Antibody [Clone ID: OTI5G1]

Sign In for Pricing
View Details
Uhrf2-set siRNA/shRNA/RNAi Lentivector (Mouse)
49155094 4x 500 ng

Uhrf2-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details