Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARHGDIA Antibody

Product Specifications

CAS Number

9007-83-4

Gene Name

Rho GDP dissociation inhibitor alpha

Gene Aliases

Epididymis secretory sperm binding protein Li 47e; GDIA1; GDP-dissociation inhibitor, aplysia RAS-related 1; HEL-S-47e; NPHS8; Rho GDP dissociation inhibitor (GDI) alpha; rho GDP-dissociation inhibitor 1; RHOGDI; Rho-GDI alpha; RHOGDI-1.

Gene ID

396

Swiss Prot

P52565

Reactivity

Human|Mouse|Rat

Immunogen

The antiserum was produced against synthesized peptide derived from human ARHGDIA.

Target

Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDH

Applications

Enzyme-linked immunosorbent assay|Immunofluorescence|Immunohistochemistry-Paraffin

Purification

The antibody was purified from rabbit antiserum by affinity-chromatography using immunogen.

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

1mg/ml

Reconstitution

-20°C

Molecular Weight

23 kDa

Notes

Formerly GWB-ASC586

Specificity

ARHGDIA Antibody detects endogenous levels of total ARHGDIA protein.

NCBI Gene Symbol

ARHGDIA

Host or Source

Rabbit

Protein Name

Rho GDP-dissociation inhibitor 1

Gene Name URL

ARHGDIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fcmr (NM_026976) Mouse Tagged ORF Clone Lentiviral Particle
MR222363L3V 200 µL

Fcmr (NM_026976) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti Mouse CD335 Flow Cytometry Monoclonal Clone  29A14 FITC 100ug
IRTAMSCD33529A14CFITC100UG 100 µg

Anti Mouse CD335 Flow Cytometry Monoclonal Clone 29A14 FITC 100ug

Sign In for Pricing
View Details
Anti-NSD3 Antibody Picoband®, Carrier-free
A32443-1-carrier-free 100 µg/Vial

Anti-NSD3 Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
QPCTL, CT (QPCTL, Glutaminyl-peptide cyclotransferase-like protein, Golgi-resident glutaminyl-peptide cyclotransferase, isoQC) (PE) discontinued
040721-PE 200 µL

QPCTL, CT (QPCTL, Glutaminyl-peptide cyclotransferase-like protein, Golgi-resident glutaminyl-peptide cyclotransferase, isoQC) (PE) discontinued

Sign In for Pricing
View Details
anti-ALF
YF-PA17382 100 ug

anti-ALF

Sign In for Pricing
View Details
Human Splicing Factor 4 (SF4) ELISA Kit
QY-E02870 96 Tests

Human Splicing Factor 4 (SF4) ELISA Kit

Sign In for Pricing
View Details