Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfkbiz Antibody-C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta

Gene Aliases

M, INAP, Mail, AA408868

Gene ID

80859

Swiss Prot

Q9EST8-2

Accession Number

NP_001152866.1

Reactivity

Mouse

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of mouse NFKBIZ

Target

Involved in regulation of NF-kappa-B transcription factor complexes. Inhibits NF-kappa-B activity without affecting its nuclear translocation upon stimulation. Inhibits DNA-binding of RELA and NFKB1/p50, and of the NF-kappa-B p65-p50 heterodimer and the NF-kappa-B p50-p50 homodimer. Seems also to activate NF-kappa-B-mediated transcription. In vitro, upon association with NFKB1/p50 has transcriptional activation activity and, together with NFKB1/p50 and RELA, is recruited to LCN2 promoters. Promotes transcription of LCN2 and DEFB4. Is recruited to IL-6 promoters and activates IL-6 but decreases TNF-alpha production in response to LPS. Seems to be involved in the induction of inflammatory genes activated through TLR/IL-1 receptor signaling. May promote apoptosis (By similarity) . Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR) .

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

69 kDa

Protein Length

629

NCBI Gene Symbol

NFKBIZ

Host or Source

Rabbit

Protein Name

NF-kappa-B inhibitor zeta

Gene Name URL

NFKBIZ

Nucleotide Accession Number

NM_001159394.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NPRL3 sgRNA gene knockout kit - Lentiviral human NPRL3 sgRNA gene knockout kit (plasmid)
GTR15369992 1 Vial

Lentiviral human NPRL3 sgRNA gene knockout kit - Lentiviral human NPRL3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Mouse Monoclonal GPR83 Antibody (566133) [Janelia Fluor 646]
FAB10943J 0.1 mL

Mouse Monoclonal GPR83 Antibody (566133) [Janelia Fluor 646]

Sign In for Pricing
View Details
Human PDE4A Protein, His Tag (MALS verified)
PDA-H55H3-50ug 50 µg

Human PDE4A Protein, His Tag (MALS verified)

Sign In for Pricing
View Details
KRTAP24-1 (NM_001085455) Human Tagged ORF Clone
RG222727 10 µg

KRTAP24-1 (NM_001085455) Human Tagged ORF Clone

Sign In for Pricing
View Details
P2RX6 Protein Vector (Rat) (pPB-N-His)
PV292087 500 ng

P2RX6 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida TodF product hydratase (todJ)
MBS1094035-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida TodF product hydratase (todJ)

Sign In for Pricing
View Details