Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CROT Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Carnitine O-octanoyltransferase

Gene Aliases

COT

Gene ID

54677

Swiss Prot

Q9UKG9-3

Accession Number

NP_001137407.1

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CROT

Target

This gene encodes a member of the carnitine/choline acetyltransferase family. The encoded protein converts 4,8-dimethylnonanoyl-CoA to its corresponding carnitine ester. This transesterification occurs in the peroxisome and is necessary for transport of medium- and long- chain acyl-CoA molecules out of the peroxisome to the cytosol and mitochondria. The protein thus plays a role in lipid metabolism and fatty acid beta-oxidation. Alternatively spliced transcript variants have been described.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FGCNCDHAPFDAMIMVNISYYVDEKIFQNEGRWKGSEKVRDIPLPEELIF

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

70 kDa

Protein Length

640

NCBI Gene Symbol

CROT

Host or Source

Rabbit

Protein Name

Peroxisomal carnitine O-octanoyltransferase

Gene Name URL

CROT

Nucleotide Accession Number

NM_001143935.1

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PPK19 Polyclonal Antibody
MBS7181459 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) PPK19 Polyclonal Antibody

Sign In for Pricing
View Details
SAMD7 CRISPR All-in-one AAV vector set (with saCas9)(Human)
43001151 3x 1.0 µg DNA

SAMD7 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
UMPS (ODC, OMPdecase, OPRT, OPRTase, Orotate Phosphoribosyl Transferase and Orotidine 5' Decarboxylase, Orotate PhosphoribosylTransferase, Orotate PhosphoribosylTransferase PhosphoribosylTransferase, Orotidine 5' phosphate Decarboxylase, Orotidine 5''-phosphate Decarboxylase, RP11-71H17.9, UMP Synthase, Umps, UMPS_HUMAN, Uridine 5' Monophosphate Synthase, Uridine Monophosphate Synthetase) discontinued
226591-01 50 µL

UMPS (ODC, OMPdecase, OPRT, OPRTase, Orotate Phosphoribosyl Transferase and Orotidine 5' Decarboxylase, Orotate PhosphoribosylTransferase, Orotate PhosphoribosylTransferase PhosphoribosylTransferase, Orotidine 5' phosphate Decarboxylase, Orotidine 5''-phosphate Decarboxylase, RP11-71H17.9, UMP Synthase, Umps, UMPS_HUMAN, Uridine 5' Monophosphate Synthase, Uridine Monophosphate Synthetase) discontinued

Sign In for Pricing
View Details
UMPS (ODC, OMPdecase, OPRT, OPRTase, Orotate Phosphoribosyl Transferase and Orotidine 5' Decarboxylase, Orotate PhosphoribosylTransferase, Orotate PhosphoribosylTransferase PhosphoribosylTransferase, Orotidine 5' phosphate Decarboxylase, Orotidine 5''-phosphate Decarboxylase, RP11-71H17.9, UMP Synthase, Umps, UMPS_HUMAN, Uridine 5' Monophosphate Synthase, Uridine Monophosphate Synthetase) discontinued
226591-02 100 µL

UMPS (ODC, OMPdecase, OPRT, OPRTase, Orotate Phosphoribosyl Transferase and Orotidine 5' Decarboxylase, Orotate PhosphoribosylTransferase, Orotate PhosphoribosylTransferase PhosphoribosylTransferase, Orotidine 5' phosphate Decarboxylase, Orotidine 5''-phosphate Decarboxylase, RP11-71H17.9, UMP Synthase, Umps, UMPS_HUMAN, Uridine 5' Monophosphate Synthase, Uridine Monophosphate Synthetase) discontinued

Sign In for Pricing
View Details
Recombinant Hesperocyparis arizonica Pectate lyase 1
CSB-EP871029COADd1-01 20 µg

Recombinant Hesperocyparis arizonica Pectate lyase 1

Sign In for Pricing
View Details
Recombinant Hesperocyparis arizonica Pectate lyase 1
CSB-EP871029COADd1-02 100 µg

Recombinant Hesperocyparis arizonica Pectate lyase 1

Sign In for Pricing
View Details