Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hesperocyparis arizonica Pectate lyase 1

Product Specifications

Product Name Alternative

Major pollen allergen Cup a 1 Allergen: Cup a 1

Abbreviation

Recombinant Hesperocyparis arizonica Pectate lyase 1 protein

UniProt

Q9SCG9

Expression Region

22-367aa

Organism

Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)

Target Sequence

DNPIDSCWRGDSNWDQNRMKLADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGADVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Allergen

Relevance

Has pectate lyase activity.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has pectate lyase activity.

Molecular Weight

65.1 kDa

References & Citations

"Molecular cloning of major allergen from Cupressus arizonica pollen: Cup a 1."Aceituno E., Del Pozo V., Minguez A., Arrieta I., Cortegano I., Cardaba B., Gallardo S., Rojo M., Palomino P., Lahoz C.Clin. Exp. Allergy 30:1750-1758 (2000)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FOLR1 AssayLite™ Antibody (APC Conjugate)
32583-05161 5x 30 µg

Human FOLR1 AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
OR2M2 Overexpression Lysate (Native) - (Dry Ice)
NBP2-08889 0.1 mg

OR2M2 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Human Wingless Type MMTV Integration Site Family, Member 5B (WNT5B) ELISA Kit
QY-E01019 96 Tests

Human Wingless Type MMTV Integration Site Family, Member 5B (WNT5B) ELISA Kit

Sign In for Pricing
View Details
MAOB Antibody
A28003-100UG 100 µg

MAOB Antibody

Sign In for Pricing
View Details
FAM32A (NM_014077) Human Over-expression Lysate
LS026017-20ug 20 µg

FAM32A (NM_014077) Human Over-expression Lysate

Sign In for Pricing
View Details
GGCX Protein Vector (Mouse) (pPM-C-His)
PV181829 500 ng

GGCX Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details