Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Growth Hormone R/GHR, Mouse (HEK293, His)

Growth hormone R/GHR protein, as a receptor for pituitary growth hormone, plays a crucial role in regulating postpartum body growth. Ligand binding activates the JAK2/STAT5 pathway, affecting downstream signaling in growth regulation. Growth Hormone R/GHR Protein, Mouse (HEK293, His) is the recombinant mouse-derived Growth Hormone R/GHR protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

Growth Hormone R/GHR Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/growth-hormone-r-ghr-protein-mouse-hek293-his.html

Purity

95.00

Smiles

TPATLGKASPVLQRINPSLGTSSSGKPRFTKCRSPELETFSCYWTEGDNPDLKTPGSIQLYYAKRESQRQAARIAHEWTQEWKECPDYVSAGKNSCYFNSSYTSIWIPYCIKLTTNGDLLDQKCFTVDEIVQPDPPIGLNWTLLNISLTGIRGDIQVSWQPPPNADVLKGWIILEYEIQYKEVNESKWKVMGPIWLTYCPVYSLRMDKEHEVRVRSRQRSFEKYSEFSEVLRVIFPQTNILEACEEDIQ

Molecular Formula

14600 (Gene_ID) P16882/NP_034414.2 (T25-Q273) (Accession)

Molecular Weight

40-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Caspase 4/Casp4 Antibody Picoband® (Dylight594 Conjugate)
A02941-2-Dylight594 100 µg

Anti-Caspase 4/Casp4 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
IdeS Protein, Streptococcus pyogenes, Recombinant (His & GST)
TMPY-06179 20 KU

IdeS Protein, Streptococcus pyogenes, Recombinant (His & GST)

Sign In for Pricing
View Details
Ocm 3'UTR GFP Stable Cell Line
TU164509 1.0 mL

Ocm 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Multodisc Yeasts
95280 100/Pack

Multodisc Yeasts

Sign In for Pricing
View Details
Digitonin (water-soluble)
19390-04 100 mg

Digitonin (water-soluble)

Sign In for Pricing
View Details
Recombinant Shigella Sonnei rplK Protein (aa 2-142)
VAng-0112Lsx-50gEcoli 50 µg (E. coli)

Recombinant Shigella Sonnei rplK Protein (aa 2-142)

Sign In for Pricing
View Details