Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Morf4l1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Mortality factor 4 like 1

Gene Aliases

MRG1, MORFR, MRG15, Tex189, TEG-189, MORFRG15, mKIAA4002

Gene ID

21761

Swiss Prot

P60762

Accession Number

NP_001034236

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Target

Morf4l1 is a component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage. Also component of the mSin3A complex which acts to repress transcription by deacetylation of nucleosomal histones.

Partner Proteins

Nanog; Hdac1; Phf12; Sin3b; Rb1; MRFAP1; Vezf1; Rnf2; Kdm5b; SIN3A; TLE1; PFN2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

PEELKPWLVDDWDLITRQKQLFYLPAKKNVDSILEDYANYKKSRGNTDNK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

41kDa

Protein Length

362

NCBI Gene Symbol

MORF4L1

Host or Source

Rabbit

Protein Name

Mortality factor 4-like protein 1

Gene Name URL

Morf4l1

Nucleotide Accession Number

NM_001039147

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADCK4 Protein Vector (Rat) (pPM-C-His)
PV252361 500 ng

ADCK4 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
IL22RA1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV636527 1.0 µg DNA

IL22RA1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Mouse Monoclonal RUNX3/CBFA3 Antibody (2B9G4) [Alexa Fluor 647]
NBP2-22390AF647 0.1 mL

Mouse Monoclonal RUNX3/CBFA3 Antibody (2B9G4) [Alexa Fluor 647]

Sign In for Pricing
View Details
SGT1 (ECD) (NM_007265) Human Recombinant Protein
TP300384L 1 mg

SGT1 (ECD) (NM_007265) Human Recombinant Protein

Sign In for Pricing
View Details
CCL3 Human shRNA Plasmid Kit (Locus ID 6348)
TR314146 1 Kit

CCL3 Human shRNA Plasmid Kit (Locus ID 6348)

Sign In for Pricing
View Details
Human SYCE2 qPCR Primer Pair
QH69993S 200 Tests

Human SYCE2 qPCR Primer Pair

Sign In for Pricing
View Details