What is the catalog number for MKI67IP antibody - middle region (ARP41054_P050)?

The catalog number for MKI67IP antibody - middle region (ARP41054_P050) is ARP41054_P050.

What sizes are available for MKI67IP antibody - middle region (ARP41054_P050)?

MKI67IP antibody - middle region (ARP41054_P050) is available in the following size(s): 100 µL.

Is MKI67IP antibody - middle region (ARP41054_P050) in stock?

MKI67IP antibody - middle region (ARP41054_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

MKI67IP antibody - middle region (ARP41054_P050)

Selected Variant

ARP41054_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Nucleolar protein interacting with the FHA domain of MKI67

Gene Aliases

Nopp34, MKI67IP

Gene ID

84365

Swiss Prot

Q9BYG3

Accession Number

NP_115766

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MKI67IP

Target

This gene encodes a protein that interacts with the forkhead-associated domain of the Ki-67 antigen. The encoded protein may bind RNA and may play a role in mitosis and cell cycle progression. Multiple pseudogenes exist on chromosomes 5, 10, 12, 15, and 19.

Partner Proteins

TNIP1; SUMO3; UBC; LIN28B; SUMO1; ADARB1; EED; RNF2; CSNK2A2; Cbx5; Cbx3; Cbx1; CBX8; FTSJ3; NOP58; MED4; GNL3; RRS1; CDK19; RPL23; RPS24; RPS15A; RPS8; RPS6; RPS3; RPS2; RPL31; RPL30; RPL19; RPL18A; RPL18; RPL15; RPL11; RPL7; RPL5; RPL4; NOP2; NHP2L1; FB

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

32kDa

Protein Length

293

NCBI Gene Symbol

NIFK

Host or Source

Rabbit

Protein Name

MKI67 FHA domain-interacting nucleolar phosphoprotein

Gene Name URL

NIFK

Nucleotide Accession Number

NM_032390

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), CF405S conjugate, 0.1mg/mL

BNC041948-100 1x 100 µL