IL-1 alpha, Rat (CHO)

APHSFQNNLRYKLIRIVKQEFIMNDSLNQNIYVDMDRIHLKAASLNDLQLEVKFDMYAYSSGGDDSKYPVTLKVSNTQLFVSAQGEDKPVLLKEIPETPKLITGSETDLIFFWEKINSKNYFTSAAFPELLIATKEQSQVHLARGLPSMIDFQIS

[1]Cavalli G, et al. Interleukin 1α: a comprehensive review on the role of IL-1α in the pathogenesis and treatment of autoimmune and inflammatory diseases. Autoimmun Rev. 2021 Mar;20 (3) :102763.|[2]Wu T, et al. Involvement of p38 and p42/44 MAP kinases and protein kinase C in the interferon-gamma and interleukin-1alpha-induced phosphorylation of 85-kDa cytosolic phospholipase A (2) in primary human bronchial epithelial cells. Cytokine. 2004 Jan 7;25 (1) :11-20.|[3]Um JY, et al. Functional polymorphism of IL-1 alpha and its potential role in obesity in humans and mice. PLoS One. 2011;6 (12) :e29524.|[4]Guo C, et al. IL-1α induces apoptosis and inhibits the osteoblast differentiation of MC3T3-E1 cells through the JNK and p38 MAPK pathways. Int J Mol Med. 2016 Jul;38 (1) :319-27.|[5]Malik A, et al. Function and regulation of IL-1α in inflammatory diseases and cancer. Immunol Rev. 2018 Jan;281 (1) :124-137.