Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FKBP14, Human (HEK293, His)

The FKBP14 protein is a peptidyl prolyl cis-trans isomerase (PPIase) that uniquely accelerates protein folding, particularly in protein synthesis. FKBP14 particularly favors 4-hydroxyproline-modified substrates, exhibits significant affinity for type III collagen, and has potential effects on type VI and type X collagen. FKBP14 Protein, Human (HEK293, His) is the recombinant human-derived FKBP14 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

FKBP14 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/fkbp14-protein-human-hek293-his.html

Purity

95.00

Smiles

ALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGKGKIPPESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKDEVKAYLKKEFEKHGAVVNESHHDALVEDIFDKEDEDKDGFISAREFTYK

Molecular Formula

55033 (Gene_ID) Q9NWM8 (A20-K207) (Accession)

Molecular Weight

Approximately 25&27 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Keto Valproic Acid Sodium Salt
sc-216476 100 mg

3-Keto Valproic Acid Sodium Salt

Sign In for Pricing
View Details
CMTM4 Polyclonal Antibody
orb1414225 100 µL

CMTM4 Polyclonal Antibody

Sign In for Pricing
View Details
CD33 Antibody
orb1333735 100 µg

CD33 Antibody

Sign In for Pricing
View Details
Recombinant Rat D (3) dopamine receptor (Drd3)
orb2904193-01 20 µg

Recombinant Rat D (3) dopamine receptor (Drd3)

Sign In for Pricing
View Details
Recombinant Rat D (3) dopamine receptor (Drd3)
orb2904193-02 100 µg

Recombinant Rat D (3) dopamine receptor (Drd3)

Sign In for Pricing
View Details
Mouse Monoclonal Thyroid Peroxidase Antibody (TPO35) [FITC]
NBP1-50813F 0.25 mL

Mouse Monoclonal Thyroid Peroxidase Antibody (TPO35) [FITC]

Sign In for Pricing
View Details