Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat D (3) dopamine receptor (Drd3)

This Recombinant Rat D (3) dopamine receptor (Drd3) spans the amino acid sequence from region 1-446.

Product Specifications

Product Name Alternative

D (3) dopamine receptor, Dopamine D3 receptor

UniProt

P19020

Expression Region

1-446

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPLSQISTHLNSTCGAENSTGVNRARPHAYYALSYCALILAIIFGNGLVCAAVLRERAL QTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILN LCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPSI CSISNPDFVIYSSVVSFYVPFGVTVLVYARIYIVLRQRQRKRILTRQNSQCISIRPGFPQ QSSCLRLHPIRQFSIRARFLSDATGQMEHIEDKQYPQKCQDPLLSHLQPPSPGQTHGGLK RYYSICQDTALRHPSLEGGAGMSPVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLRLGP LQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACHVSPELYRATTWLGYV NSALNPVIYTTFNVEFRKAFLKILSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement Factor H (CFH, H Factor 1, HF, HF1, HF2, beta1 H-globulin, b1H Globulin) (MaxLight 490) discontinued
C7850-82B-ML490 100 µL

Complement Factor H (CFH, H Factor 1, HF, HF1, HF2, beta1 H-globulin, b1H Globulin) (MaxLight 490) discontinued

Sign In for Pricing
View Details
RGD1562665 Protein Vector (Rat) (pPM-C-HA)
39296026 500 ng

RGD1562665 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) foxred2 Polyclonal Antibody
MBS7139315 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) foxred2 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human PHGR1 Protein, N-His-KSI
orb3154030-01 50 µg

Recombinant Human PHGR1 Protein, N-His-KSI

Sign In for Pricing
View Details
Recombinant Human PHGR1 Protein, N-His-KSI
orb3154030-02 100 µg

Recombinant Human PHGR1 Protein, N-His-KSI

Sign In for Pricing
View Details
Recombinant Human PHGR1 Protein, N-His-KSI
orb3154030-03 1 mg

Recombinant Human PHGR1 Protein, N-His-KSI

Sign In for Pricing
View Details