Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tenascin/Tnc, Mouse (HEK293, His-Myc)

Tenascin/Tnc proteins guide neuronal and axonal migration and contribute to development, synaptic plasticity, and neuronal regeneration. Tenascin/Tnc Protein, Mouse (HEK293, His-Myc) is the recombinant mouse-derived Tenascin/Tnc protein, expressed by HEK293 , with N-10*His, C-Myc labeled tag.

Product Specifications

Product Name Alternative

Tenascin/Tnc Protein, Mouse (HEK293, His-Myc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tenascin-tnc-protein-mouse.html

Purity

98.0

Smiles

GLLYPFPRDCSQAMLNGDTTSGLYTIYINGDKTQALEVYCDMTSDGGGWIVFLRRKNGREDFYRNWKAYAAGFGDRREEFWLGLDNLSKITAQGQYELRVDLQDHGESAYAVYDRFSVGDAKSRYKLKVEGYSGTAGDSMNYHNGRSFSTYDKDTDSAITNCALSYKGAFWYKNCHRVNLMGRYGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSN

Molecular Formula

21923 (Gene_ID) Q80YX1-1 (G1884-N2099) (Accession)

Molecular Weight

27-31 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME3 Protein Vector (Human) (pPB-C-His)
PV028461 500 ng

NME3 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
4- (5-Mercapto-1,3,4-oxadiazol-2-yl) benzoic acid
OR1046858-01 100 mg

4- (5-Mercapto-1,3,4-oxadiazol-2-yl) benzoic acid

Sign In for Pricing
View Details
4- (5-Mercapto-1,3,4-oxadiazol-2-yl) benzoic acid
OR1046858-02 250 mg

4- (5-Mercapto-1,3,4-oxadiazol-2-yl) benzoic acid

Sign In for Pricing
View Details
4- (5-Mercapto-1,3,4-oxadiazol-2-yl) benzoic acid
OR1046858-03 1 g

4- (5-Mercapto-1,3,4-oxadiazol-2-yl) benzoic acid

Sign In for Pricing
View Details
4- (5-Mercapto-1,3,4-oxadiazol-2-yl) benzoic acid
OR1046858-04 5 g

4- (5-Mercapto-1,3,4-oxadiazol-2-yl) benzoic acid

Sign In for Pricing
View Details
Recombinant Rat Adenosine receptor A1 (Adora1)
MBS1005513 Inquire

Recombinant Rat Adenosine receptor A1 (Adora1)

Sign In for Pricing
View Details