Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACPS, Streptococcus pyogenes serotype M28 (His)

ACPS, an essential enzyme in cellular processes, transfers the 4'-phosphopantetheine moiety from coenzyme A to a serine residue of acyl-carrier-protein. ACPS Protein, Streptococcus pyogenes serotype M28 (His) is the recombinant ACPS protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

ACPS Protein, Streptococcus pyogenes serotype M28 (His), Others, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/acps-protein-streptococcus-pyogenes-serotype-m28.html

Purity

95.0

Smiles

MIVGHGIDLQEISAIEKVYQRNPRFAQKILTEQELAIFESFPYKRRLSYLAGRWAGKEAFAKAIGTGIGRLTFQDIEILNDVRGCPILTKSPFKGNSFISISHSGNYVQASVILEDKK

Molecular Formula

/ (Gene_ID) Q48RM7 (M1-K118) (Accession)

Molecular Weight

Approximately 15 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Type I
C7510-10W-01 100 µL

Collagen Type I

Sign In for Pricing
View Details
Collagen Type I
C7510-10W-02 200 µL

Collagen Type I

Sign In for Pricing
View Details
Recombinant Cit r 3
E4A10S30 100 µg

Recombinant Cit r 3

Sign In for Pricing
View Details
LRRC58 (NM_001099678) Human Tagged ORF Clone Lentiviral Particle
RC211354L4V 200 µL

LRRC58 (NM_001099678) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
She CRISPR Activation Plasmid (m)
sc-431943-ACT 20 µg

She CRISPR Activation Plasmid (m)

Sign In for Pricing
View Details
CAPG polyclonal antibody
AP6017-01 50 µL

CAPG polyclonal antibody

Sign In for Pricing
View Details