Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Collagen alpha-2 (VI) chain (COL6A2), partial

Product Specifications

Product Name Alternative

CO6A2_HUMAN; COL6A2; Collagen alpha 2 (VI) chain; Collagen alpha-2 (VI) chain; collagen type VI alpha 2; Collagen VI alpha 2 polypeptide; human mRNA for collagen VI alpha 2 C terminal globular domain; PP3610

Abbreviation

Recombinant Human COL6A2 protein, partial

Gene Name

COL6A2

UniProt

P12110

Expression Region

941-1016aa

Organism

Homo sapiens (Human)

Target Sequence

ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Collagen VI acts as a cell-binding protein.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.3 kDa

References & Citations

"Amino acid sequence of the triple-helical domain of human collagen type VI." Chu M.-L., Conway D., Pan T.-C., Baldwin C., Mann K., Deutzmann R., Timpl R. J. Biol. Chem. 263:18601-18606 (1988)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L801 (MIMI_L801)
orb2932687-01 20 µg

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L801 (MIMI_L801)

Sign In for Pricing
View Details
Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L801 (MIMI_L801)
orb2932687-02 100 µg

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L801 (MIMI_L801)

Sign In for Pricing
View Details
Rabbit Monoclonal S1P5/EDG-8 Antibody (1196A) [DyLight 488]
FAB9084K 0.1 mL

Rabbit Monoclonal S1P5/EDG-8 Antibody (1196A) [DyLight 488]

Sign In for Pricing
View Details
Human SLC22A2 Knockout HEK293T cell line
GTR15421064 1 Vial

Human SLC22A2 Knockout HEK293T cell line

Sign In for Pricing
View Details
ABCG2 Rabbit Polyclonal Antibody
orb625099-01 50 µg

ABCG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ABCG2 Rabbit Polyclonal Antibody
orb625099-02 100 µg

ABCG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details