Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L801 (MIMI_L801)

This Recombinant Acanthamoeba polyphaga mimivirus Uncharacterized protein L801 (MIMI_L801) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Uncharacterized protein L801

UniProt

Q5UR61

Expression Region

1-131

Origin

Acanthamoeba polyphaga mimivirus (APMV)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHNKRYNPDVVIDFGVDFSNDYNKSKNKFFDRYIIFNKDFMKYIFKLALRALIMIGIIEL SYFISLGGFYLVSNDPIYFRNLSIFHARGVEFATECSDIISIFCSIAFVLFCIYDVGKYY VTKCKSSKRYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Regucalcin (RGN) ELISA Kit
MBS2805259-01 48 Tests

Human Regucalcin (RGN) ELISA Kit

Sign In for Pricing
View Details
Human Regucalcin (RGN) ELISA Kit
MBS2805259-02 96 Tests

Human Regucalcin (RGN) ELISA Kit

Sign In for Pricing
View Details
Human Regucalcin (RGN) ELISA Kit
MBS2805259-03 5x 96 Tests

Human Regucalcin (RGN) ELISA Kit

Sign In for Pricing
View Details
Human Regucalcin (RGN) ELISA Kit
MBS2805259-04 10x 96 Tests

Human Regucalcin (RGN) ELISA Kit

Sign In for Pricing
View Details
C4ORF28 (PACRGL) (NM_001130727) Human Tagged ORF Clone
RC225069 10 µg

C4ORF28 (PACRGL) (NM_001130727) Human Tagged ORF Clone

Sign In for Pricing
View Details
DSPE-PEG-HD37Fab′
MPL0768K Each

DSPE-PEG-HD37Fab′

Sign In for Pricing
View Details