Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Deoxyribonuclease gamma (DNASE1L3)

Product Specifications

Product Name Alternative

DNase I homolog protein DHP2 (Deoxyribonuclease I-like 3) (DNase I-like 3) (Liver and spleen DNase) (LS-DNase) (LSD) (DNase gamma) (DHP2) (DNAS1L3)

Abbreviation

Recombinant Human DNASE1L3 protein

Gene Name

DNASE1L3

UniProt

Q13609

Expression Region

21-305aa

Organism

Homo sapiens (Human)

Target Sequence

MRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Baculovirus

Field of Research

Others

Relevance

Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends. Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA. Acts in internucleosomal DNA fragmentation during apoptosis and necrosis. The role in apoptosis includes myogenic and neuronal differentiation, and BCR-mediated clonal deletion of self-reactive B cells. Is active on chromatin in apoptotic cell-derived membrane-coated microparticles and thus suppresses anti-DNA autoimmunity. Together with DNASE1, plays a key role in degrading neutrophil extracellular traps. NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens during inflammation. Degradation of intravascular NETs by DNASE1 and DNASE1L3 is required to prevent formation of clots that obstruct blood vessels and cause organ damage following inflammation.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Has DNA hydrolytic activity. Is capable of both single- and double-stranded DNA cleavage, producing DNA fragments with 3'-OH ends (By similarity) . Can cleave chromatin to nucleosomal units and cleaves nucleosomal and liposome-coated DNA

Molecular Weight

35.8 kDa

References & Citations

"DNase gamma is the effector endonuclease for internucleosomal DNA fragmentation in necrosis." Mizuta R., Araki S., Furukawa M., Furukawa Y., Ebara S., Shiokawa D., Hayashi K., Tanuma S., Kitamura D. PLoS ONE 8:E80223-E80223 (2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K1 Recombinant Rabbit Monoclonal Antibody [PSH06-10]
HA722507 100 µL

MAP3K1 Recombinant Rabbit Monoclonal Antibody [PSH06-10]

Sign In for Pricing
View Details
Human DCAF17 activation kit by CRISPRa
GA112810 1 Kit

Human DCAF17 activation kit by CRISPRa

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF405S conjugate, 0.1mg/mL
BNC041577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (C5/473 + CD5/54/F6), CF594 conjugate, 0.1mg/mL
BNC940748-100 1x 100 µL

CD5 (C5/473 + CD5/54/F6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cystatin-B Recombinant Rabbit Monoclonal Antibody [JE63-34]
HA720084 100 µL

Cystatin-B Recombinant Rabbit Monoclonal Antibody [JE63-34]

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon: sigmoid
CS804867 5x 5 µm

Tissue FFPE Sections, Colon: sigmoid

Sign In for Pricing
View Details