Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium salinarum Cobalamin import ATP-binding protein BtuD (btuD)

Product Specifications

Product Name Alternative

Vitamin B12-transporting ATPase

Abbreviation

Recombinant Halobacterium salinarum btuD protein

Gene Name

BtuD

UniProt

B0R5G4

Expression Region

1-398aa

Organism

Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

Target Sequence

MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLPDRTSAAADTSVHVVGGGDSATPVVRRLVSAGASVSVGPVVEGDTDHETARRVGCPCTSVAPFTRLEDTTAASATRADIAAADVIAVPVAAAARPGVRGLLTGAVPTLAVGDAAGAPEWADRLVACDAVVSAVGALADTPSDGV

Tag

Tag-Free

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin import. Probably responsible for energy coupling to the transport system.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably responsible for energy coupling to the transport system (By similarity) .

Molecular Weight

40.5 kDa

References & Citations

"Evolution in the laboratory: the genome of Halobacterium salinarum strain R1 compared to that of strain NRC-1." Pfeiffer F., Schuster S.C., Broicher A., Falb M., Palm P., Rodewald K., Ruepp A., Soppa J., Tittor J., Oesterhelt D. Genomics 91:335-346 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV686036 1.0 µg DNA

MAF Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Bovine Luteinizing Hormone-Releasing Hormone ELISA Kit
MBS011406-01 48 Well

Bovine Luteinizing Hormone-Releasing Hormone ELISA Kit

Sign In for Pricing
View Details
Bovine Luteinizing Hormone-Releasing Hormone ELISA Kit
MBS011406-02 96 Well

Bovine Luteinizing Hormone-Releasing Hormone ELISA Kit

Sign In for Pricing
View Details
Bovine Luteinizing Hormone-Releasing Hormone ELISA Kit
MBS011406-03 5x 96 Well

Bovine Luteinizing Hormone-Releasing Hormone ELISA Kit

Sign In for Pricing
View Details
Bovine Luteinizing Hormone-Releasing Hormone ELISA Kit
MBS011406-04 10x 96 Well

Bovine Luteinizing Hormone-Releasing Hormone ELISA Kit

Sign In for Pricing
View Details
IRF8 Antibody
61-533 400 µL

IRF8 Antibody

Sign In for Pricing
View Details