Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 1 (FGF1)

Product Specifications

Product Name Alternative

Acidic fibroblast growth factor (aFGF) (Endothelial cell growth factor) (ECGF) (Heparin-binding growth factor 1) (HBGF-1) (FGF-1) (FGFA)

Abbreviation

Recombinant Human FGF1 protein

Gene Name

FGF1

UniProt

P05230

Expression Region

16-155aa

Organism

Homo sapiens (Human)

Target Sequence

FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV:ITGB3. Its binding to integrin, subsequent ternary complex formation with integrin and FGFR1, and the recruitment of PTPN11 to the complex are essential for FGF1 signaling. Induces the phosphorylation and activation of FGFR1, FRS2, MAPK3/ERK1, MAPK1/ERK2 and AKT1 . Can induce angiogenesis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Acts as a ligand for FGFR1 and integrins. Binds to FGFR1 in the presence of heparin leading to FGFR1 dimerization and activation via sequential autophosphorylation on tyrosine residues which act as docking sites for interacting proteins, leading to the activation of several signaling cascades. Binds to integrin ITGAV

Molecular Weight

17.8 kDa

References & Citations

"Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S. Nat. Genet. 36:40-45 (2004)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

LYRM4 (NM_001164841) Human Untagged Clone
SC326672 10 µg

LYRM4 (NM_001164841) Human Untagged Clone

Ask
View Details
Tcte4 siRNA Oligos set (Rat)
46428176 3 x 5 nmol

Tcte4 siRNA Oligos set (Rat)

Ask
View Details
IGFL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
24332061 1.0 µg DNA

IGFL2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Ask
View Details
hsa-miR-216a-3p miRNA Agomir
MBS8312609-01 5 nmol

hsa-miR-216a-3p miRNA Agomir

Ask
View Details
hsa-miR-216a-3p miRNA Agomir
MBS8312609-02 10 nmol

hsa-miR-216a-3p miRNA Agomir

Ask
View Details
hsa-miR-216a-3p miRNA Agomir
MBS8312609-03 20 nmol

hsa-miR-216a-3p miRNA Agomir

Ask
View Details