Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Peroxiredoxin-2 (PRDX2)

Product Specifications

Product Name Alternative

Natural killer cell-enhancing factor B

Abbreviation

Recombinant Human PRDX2 protein

Gene Name

PRDX2

UniProt

P32119

Expression Region

2-198aa

Organism

Homo sapiens (Human)

Target Sequence

ASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Neuroscience

Relevance

Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H2O2.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against oxidative stress by detoxifying peroxides and as sensor of hydrogen peroxide-mediated signaling events. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H (2) O (2) .

Molecular Weight

24.3 kDa

References & Citations

"The thiol-specific antioxidant protein from human brain: gene cloning and analysis of conserved cysteine regions." Lim Y.-S., Cha M.-K., Kim H.-K., Kim I.-H. Gene 140:279-284 (1994)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANCA Protein Vector (Mouse) (pPM-C-HA)
PV178272 500 ng

FANCA Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
RHEB (NM_005614) Human Recombinant Protein
TP720962M 50 µg

RHEB (NM_005614) Human Recombinant Protein

Sign In for Pricing
View Details
Anti-TAS2R10 Antibody Picoband®, APC Conjugate
A10959-2-APC 100 µg/Vial

Anti-TAS2R10 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
ATTO Rho11
E37F572-1-1 mg 1 mg

ATTO Rho11

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS620879 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
Mouse Monoclonal Thymidylate Synthase Antibody (TS106 + TMS715) - Azide and BSA Free
NBP2-34503-0.1mg 0.1 mg

Mouse Monoclonal Thymidylate Synthase Antibody (TS106 + TMS715) - Azide and BSA Free

Sign In for Pricing
View Details