Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PHD finger protein 11 (PHF11)

Product Specifications

Product Name Alternative

BRCA1 C-terminus-associated protein Renal carcinoma antigen NY-REN-34

Abbreviation

Recombinant Human PHF11 protein

Gene Name

PHF11

UniProt

Q9UIL8

Expression Region

1-292aa

Organism

Homo sapiens (Human)

Target Sequence

MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Positive regulator of Th1-type cytokine gene expression.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Positive regulator of Th1-type cytokine gene expression.

Molecular Weight

60.5 kDa

References & Citations

"Antigens recognized by autologous antibody in patients with renal-cell carcinoma." Scanlan M.J., Gordan J.D., Williamson B., Stockert E., Bander N.H., Jongeneel C.V., Gure A.O., Jaeger D., Jaeger E., Knuth A., Chen Y.-T., Old L.J. Int. J. Cancer 83:456-464 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Lewis Y Antibody (A70-A/A9) [Janelia Fluor 549]
NBP2-54561JF549 0.1 mL

Mouse Monoclonal Lewis Y Antibody (A70-A/A9) [Janelia Fluor 549]

Sign In for Pricing
View Details
Goat anti-PLCD3 (aa261-274) Antibody
MBS423963-01 0.1 mg

Goat anti-PLCD3 (aa261-274) Antibody

Sign In for Pricing
View Details
Goat anti-PLCD3 (aa261-274) Antibody
MBS423963-02 5x 0.1 mg

Goat anti-PLCD3 (aa261-274) Antibody

Sign In for Pricing
View Details
ARC19499 (sodium)
HY-153480A-01 1 mg

ARC19499 (sodium)

Sign In for Pricing
View Details
ARC19499 (sodium)
HY-153480A-02 5 mg

ARC19499 (sodium)

Sign In for Pricing
View Details
ARC19499 (sodium)
HY-153480A-03 10 mg

ARC19499 (sodium)

Sign In for Pricing
View Details