Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia japonica 17KDA surface antigen (omp)

Product Specifications

Product Name Alternative

Omp; RJP_094417 kDa surface antigen

Abbreviation

Recombinant Rickettsia japonica omp protein

Gene Name

Omp

UniProt

Q52764

Expression Region

20-159aa

Organism

Rickettsia japonica (strain ATCC VR-1363 / YH)

Target Sequence

CNGPGGMNKQGTGTLLGGAGGALLGSQFGKGTGQLVGVGVGALLGAVLGGQIGAGMDEQDRRLAELTSQRALETAPSGSNVEWRNPDNGNYGYVTPNKTYRNSTGQYCREYTQTVVIGGKQQKAYGNACRQPDGQWQVVN

Tag

N-terminal 6xHis-SUMO-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Microbiology

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.5 kDa

References & Citations

"Specific amplification of Rickettsia japonica DNA from clinical specimens by PCR."Furuya Y., Katayama T., Yoshida Y., Kaiho I.J. Clin. Microbiol. 33:487-489 (1995)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUZP4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A10]
TA809088AM 100 µL

LUZP4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3A10]

Sign In for Pricing
View Details
Biotin Conjugated Rabbit Polyclonal Antibody to Goat IgG
BA-2357-2 2 mL

Biotin Conjugated Rabbit Polyclonal Antibody to Goat IgG

Sign In for Pricing
View Details
CrkL Recombinant Rabbit Monoclonal Antibody [JE50-21]
HA721740 100 µL

CrkL Recombinant Rabbit Monoclonal Antibody [JE50-21]

Sign In for Pricing
View Details
Human Aprataxin (APTX) activation kit by CRISPRa
GA110301 1 Kit

Human Aprataxin (APTX) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS702266 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
ReadiView™ biotin acid
3050-AAT 25 mg

ReadiView™ biotin acid

Sign In for Pricing
View Details